Name :
CD79A (Human) Recombinant Protein
Biological Activity :
Purified CD79A (NP_001774.1, 33 a.a. – 143 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro
Tag :
Protein Accession No. :
NP_001774.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=973
Amino Acid Sequence :
LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR
Molecular Weight :
15.29
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Human
Interspecies Antigen Sequence :
Mouse (58)
Preparation Method :
Transfection of pSuper-CD79A plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
Purification :
Strep-Tactin affinity columns
Quality Control Testing :
SDS-PAGE and Western Blot SDS-PAGE Gel Western Blot
Storage Buffer :
100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Applications :
Western Blot， Enzyme-linked Immunoabsorbent Assay， SDS-PAGE， Protein Interaction，
Gene Name :
CD79A
Gene Alias :
IGA, MB-1
Gene Description :
CD79a molecule, immunoglobulin-associated alpha
Gene Summary :
The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
Other Designations :
B-cell antigen receptor complex-associated protein alpha chain|CD79A antigen|CD79a antigen (immunoglobulin-associated alpha)|MB-1 membrane glycoprotein|surface IgM-associated protein
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
DDR1 Protein
Mucin-1/MUC1 Protein
Popular categories:
CD200R2
IFN-alpha/beta R2
