Name :
CD79A (Human) Recombinant Protein
Biological Activity :
Human CD79A full-length ORF (NP_001774.1) recombinant protein without tag.This product is belong to Proteoliposome (PL).Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength,Proteoliposome,Proteoliposomes,Membrane Protein,Membrane Proteins
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
NP_001774.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=973
Amino Acid Sequence :
MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
Molecular Weight :
25
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Mouse (71)
Preparation Method :
in vitro wheat germ expression system with proprietary liposome technology
Purification :
None
Quality Control Testing :
Storage Buffer :
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Applications :
Antibody Production，
Gene Name :
CD79A
Gene Alias :
IGA, MB-1
Gene Description :
CD79a molecule, immunoglobulin-associated alpha
Gene Summary :
The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
Other Designations :
B-cell antigen receptor complex-associated protein alpha chain|CD79A antigen|CD79a antigen (immunoglobulin-associated alpha)|MB-1 membrane glycoprotein|surface IgM-associated protein
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PTPRD Protein
EpCAM/TROP1 Protein
Popular categories:
CCL14
Hepatitis C Virus Proteins
