Name :
CD70 (Human) Recombinant Protein
Biological Activity :
Human CD70 full-length ORF (NP_001243.1) recombinant protein without tag.This product is belong to Proteoliposome (PL).Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength,Proteoliposome,Proteoliposomes,Membrane Protein,Membrane Proteins
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
NP_001243.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=970
Amino Acid Sequence :
MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Molecular Weight :
21.1
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Preparation Method :
in vitro wheat germ expression system with proprietary liposome technology
Purification :
None
Quality Control Testing :
Storage Buffer :
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Applications :
Antibody Production,
Gene Name :
CD70
Gene Description :
CD70 molecule
Gene Summary :
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq
Other Designations :
CD27 ligand|CD70 antigen|Ki-24 antigen|surface antigen CD70|tumor necrosis factor (ligand) superfamily, member 7|tumor necrosis factor ligand superfamily, member 7
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SCF Protein
OX40/TNFRSF4 Protein
Popular categories:
Syndecan-2/CD362
ABL1