Name :
STMN2 (Human) Recombinant Protein (Q01)
Biological Activity :
Human STMN2 partial ORF (NP_008960, 1 a.a. – 90 a.a.) recombinant protein with GST-tag at N-terminal.
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
NP_008960
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=11075
Amino Acid Sequence :
MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEA
Molecular Weight :
35.64
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Mouse (100); Rat (99)
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,
Gene Name :
STMN2
Gene Alias :
SCG10, SCGN10, SGC10
Gene Description :
stathmin-like 2
Gene Summary :
Superior cervical ganglion-10 is a neuronal growth-associated protein that shares significant amino acid sequence similarity with the phosphoprotein stathmin (MIM 151442).[supplied by OMIM
Other Designations :
neuronal growth-associated protein (silencer element)|superior cervical ganglia, neural specific 10|superiorcervical ganglia, neural specific 10
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
LOXL2 Protein
gp130/IL6ST Protein
Popular categories:
TROY Protein
Ubiquitin-Conjugating Enzyme E2 T
