Name :
EDAR (Human) Recombinant Protein
Biological Activity :
Purified EDAR (AAH93872.1, 27 a.a. – 183 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro
Tag :
Protein Accession No. :
AAH93872.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=10913
Amino Acid Sequence :
EYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKELSGQGH
Molecular Weight :
22.55
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Human
Interspecies Antigen Sequence :
Mouse (85); Rat (84)
Preparation Method :
Transfection of pSuper-EDAR plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
Purification :
Strep-Tactin affinity columns
Quality Control Testing :
Storage Buffer :
100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Applications :
Western Blot, Enzyme-linked Immunoabsorbent Assay, SDS-PAGE, Protein Interaction,
Gene Name :
EDAR
Gene Alias :
DL, ED1R, ED3, ED5, EDA-A1R, EDA1R, EDA3, FLJ94390
Gene Description :
ectodysplasin A receptor
Gene Summary :
This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia. [provided by RefSeq
Other Designations :
downless, mouse, homolog of|ectodysplasin 1, anhidrotic receptor
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cadherin-1/CD324 Protein
PD-L2 Protein
Popular categories:
Ubiquitin-Specific Protease 3
CD28
