Name :
CPLX2 (Human) Recombinant Protein (P01)
Biological Activity :
Human CPLX2 full-length ORF ( ADR82826.1, 1 a.a. – 134 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
ADR82826.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=10814
Amino Acid Sequence :
MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK
Molecular Weight :
14.8
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Mouse (100); Rat (100)
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,
Gene Name :
CPLX2
Gene Alias :
921-L, CPX-2, CPX2, Hfb1, MGC138492
Gene Description :
complexin 2
Gene Summary :
Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations :
synaphin 1
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CRKL Protein
4-1BBL/TNFSF9 Protein
Popular categories:
Adhesion GPCRs
CCL12
