Share this post on:

Name :
GJB6 (Human) Recombinant Protein (Q01)

Biological Activity :
Human GJB6 partial ORF ( AAH38934, 45 a.a. – 75 a.a.) recombinant protein with GST-tag at N-terminal.

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
AAH38934

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=10804

Amino Acid Sequence :
GDEQEDFVCNTLQPGCKNVCYDHFFPVSHIR

Molecular Weight :
29.15

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,

Gene Name :
GJB6

Gene Alias :
CX30, DFNA3, ED2, EDH, HED

Gene Description :
gap junction protein, beta 6, 30kDa

Gene Summary :
Gap junctions allow the transport of ions and metabolites between the cytoplasm of adjacent cells. They are formed by two hemichannels, made up of six connexin proteins assembled in groups. Each connexin protein has four transmembrane segments, two extracellular loops, a cytoplasmic loop formed between the two inner transmembrane segments, and the N- and C-terminus both being in the cytoplasm. The specificity of the gap junction is determined by which connexin proteins comprise the hemichannel. In the past, connexin protein names were based on their molecular weight, however the new nomenclature uses sequential numbers based on which form (alpha or beta) of the gap junction is present. This gene encodes one of the connexin proteins. Mutations in this gene have been found in some forms of deafness and in some families with hidrotic ectodermal dysplasia. [provided by RefSeq

Other Designations :
OTTHUMP00000018096|OTTHUMP00000176870|OTTHUMP00000176871|OTTHUMP00000176872|connexin 30|ectodermal dysplasia 2, hidrotic (Clouston syndrome)|gap junction protein, beta 6|gap junction protein, beta 6 (connexin 30)

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
ATF2 Protein
SARS-CoV-2 NSP7-NSP8 Heterodimer Protein (His)
Popular categories:
Zika Virus E proteins
Neurturin

Share this post on:

Author: calcimimeticagent