Share this post on:

Name :
TNFSF13B (Human) Recombinant Protein (Q01)

Biological Activity :
Human TNFSF13B partial ORF ( AAH20674.1, 118 a.a. – 222 a.a.) recombinant protein with GST-tag at N-terminal.

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
AAH20674.1

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=10673

Amino Acid Sequence :
PAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGD

Molecular Weight :
37.18

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (60); Rat (44)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,

Gene Name :
TNFSF13B

Gene Alias :
BAFF, BLYS, CD257, DTL, TALL-1, TALL1, THANK, TNFSF20, ZTNF4

Gene Description :
tumor necrosis factor (ligand) superfamily, member 13b

Gene Summary :
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR. This cytokine is expressed in B cell lineage cells, and acts as a potent B cell activator. It has been also shown to play an important role in the proliferation and differentiation of B cells. [provided by RefSeq

Other Designations :
ApoL related ligand TALL-1|B-cell activating factor|B-lymphocyte stimulator|OTTHUMP00000018691|TNF and ApoL-related leukocyte expressed ligand 1|TNF homolog that activates apoptosis|delta BAFF|dendritic cell-derived TNF-like molecule|tumor necrosis factor

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
OX40/TNFRSF4 Protein
TPO/Thrombopoietin Protein
Popular categories:
Signal Regulatory Protein Beta 1
Adenosine Receptor

Share this post on:

Author: calcimimeticagent