Name :
SMC2L1 (Human) Recombinant Protein (Q01)
Biological Activity :
Human SMC2L1 partial ORF ( NP_006435, 521 a.a. – 630 a.a.) recombinant protein with GST-tag at N-terminal.
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
NP_006435
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=10592
Amino Acid Sequence :
CVKGLVASLISVKDTSATTALELVAGERLYNVVVDTEVTGKKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPDNVHVALSLVEYKPELQKAMEFVFGTTFVC
Molecular Weight :
37.84
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Mouse (91); Rat (93)
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,
Gene Name :
SMC2
Gene Alias :
CAP-E, CAPE, FLJ10093, SMC2L1, hCAP-E
Gene Description :
structural maintenance of chromosomes 2
Gene Summary :
yeast)-like 1|SMC2 structural maintenance of chromosomes 2-like 1|chromosome-associated protein E|structural maintenance of chromosomes (SMC) family member
Other Designations :
OTTHUMP00000021818|OTTHUMP00000021819|SMC2 (structural maintenance of chromosomes 2, yeast)-like 1|SMC2 structural maintenance of chromosomes 2-like 1|chromosome-associated protein E|structural maintenance of chromosomes (SMC) family member, chromosome-as
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
OX40 Ligand/TNFSF4 Protein
P4HB Protein
Popular categories:
CD177
CEA Cell Adhesion Molecule 21
