Name : ADARB1 (Human) Recombinant Protein (Q01)
Biological Activity : Human ADARB1 partial ORF ( AAH65545, 592 a.a. – 701 a.a.) recombinant protein with GST-tag at N-terminal.
Tag : Best use within three months from the date of receipt of this protein.
Protein Accession No. : AAH65545
Protein Accession No.URL : https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=104
Amino Acid Sequence : PGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLTP
Molecular Weight : 37.84
Storage and Stability : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host : Wheat Germ (in vitro)
Interspecies Antigen Sequence : Mouse (92); Rat (94)
Preparation Method : in vitro wheat germ expression system
Purification : Glutathione Sepharose 4 Fast Flow
Quality Control Testing : 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications : Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，
Gene Name : ADARB1
Gene Alias : ADAR2, ADAR2a, ADAR2a-L1, ADAR2a-L2, ADAR2a-L3, ADAR2b, ADAR2c, ADAR2d, ADAR2g, DRABA2, DRADA2, RED1
Gene Description : adenosine deaminase, RNA-specific, B1 (RED1 homolog rat)
Gene Summary : This gene encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region. [provided by RefSeq
Other Designations : ADAR2c ADAR2d|OTTHUMP00000115341|OTTHUMP00000115342|RNA editase|RNA editing deaminase 1|RNA-specific adenosine deaminase B1|adenosine deaminase acting on RNA type2a|adenosine deaminase acting on RNA type2d|adenosine deaminase acting on RNA type2g|adenosin
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations: FGF basic/bFGF Protein EGR1/ZNF225 Protein CD25/IL-2R alpha Dectin-1
