Name :
CCL4L1 (Human) Recombinant Protein
Biological Activity :
Human CCL4L1 (Q8NHW4, 24 a.a. – 92 a.a.) partial recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
Q8NHW4
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=388372
Amino Acid Sequence :
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
Molecular Weight :
7.8
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from sterile distilled Water is > 100 ug/mL
Applications :
Functional Study, SDS-PAGE,
Gene Name :
CCL4L2
Gene Alias :
AT744.2, CCL4L, SCYA4L
Gene Description :
chemokine (C-C motif) ligand 4-like 2
Gene Summary :
This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. This protein is similar to CCL4 which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals; most individuals have 1-5 copies in the diploid genome, although rare individuals do not contain this gene at all. The human genome reference assembly contains two copies of this gene. This record represents the more telomeric gene. [provided by RefSeq
Other Designations :
CC chemokine ligand 4L1|CC chemokine ligand 4L1d2|CC chemokine ligand 4L2|chemokine (C-C motif) ligand 4-like 1, telomeric|lymphocyte activation gene 1|macrophage inflammatory protein-1b2|small inducible cytokine 4-like|small inducible cytokine A4-like
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD30/TNFRSF8 Proteinsite
SCF ProteinSource
Popular categories:
Kallistatin
Ig-alpha/CD79a
