Name :
DUSP23 (Human) Recombinant Protein
Biological Activity :
Human DUSP23 (Q9BVJ7, 1 a.a. – 150 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins,Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Protein Accession No. :
Q9BVJ7
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=54935
Amino Acid Sequence :
MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Molecular Weight :
18.8
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer :
In 20mM Tris-HCl pH 8.0 (10% glycerol, 100 mM NaCl, 2 mM DTT)
Applications :
Functional Study, SDS-PAGE,
Gene Name :
DUSP23
Gene Alias :
DUSP25, FLJ20442, LDP-3, MOSP, RP11-190A12.1, VHZ
Gene Description :
dual specificity phosphatase 23
Gene Summary :
Other Designations :
OTTHUMP00000024412|OTTHUMP00000024413|OTTHUMP00000033306|VH1-like member Z|low-molecular-mass dual-specificity phosphatase 3
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-31 Proteinmanufacturer
CXCL16 ProteinMolecular Weight
Popular categories:
VEGFR-1
Betacellulin