Name :
ICOS (Human) Recombinant Protein
Biological Activity :
Human ICOS (Q9Y6W8, 21 a.a. – 141 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cell.Recombinant Human Protein,Recombinant Human Proteins,Human Recombinant Protein,Human Recombinant Proteins,HuPro
Tag :
Protein Accession No. :
Q9Y6W8
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=29851
Amino Acid Sequence :
EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKF
Molecular Weight :
50.5
Storage and Stability :
Store at 4°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Mammals
Interspecies Antigen Sequence :
Preparation Method :
Mammalian cell (HEK293) expression system
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from sterile distilled Water up to 100 ug/mL
Applications :
Functional Study， SDS-PAGE，
Gene Name :
ICOS
Gene Alias :
AILIM, CD278, MGC39850
Gene Description :
inducible T-cell co-stimulator
Gene Summary :
The protein encoded by this gene belongs to the CD28 and CTLA-4 cell-surface receptor family. It forms homodimers and plays an important role in cell-cell signaling, immune responses, and regulation of cell proliferation. [provided by RefSeq
Other Designations :
activation-inducible lymphocyte immunomediatory molecule|inducible costimulator
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-3 ProteinGene ID
B7-1/CD80 ProteinSpecies
Popular categories:
Constitutive Androstane Receptor
Ubiquitin-Conjugating Enzyme E2 D3
