Share this post on:

Name :
ccmG (Escherichia coli) Recombinant protein

Biological Activity :
Escherichia coli ccmG (NP_416699, 26 a.a. – 185 a.a.) partial recombinant protein expressed in Escherichia coli.

Tag :

Protein Accession No. :
NP_416699

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=949073

Amino Acid Sequence :
MRNAEGDDPTNLESALIGKPVPKFRLESLDNPGQFYQADVLTQGKPVLLNVWATWCPTCRAEHQYLNQLSAQGIRVVGMNYKDDRQKAISWLKELGNPYALSLFDGDGMLGLDLGVYGAPETFLIDGNGIIRYRHAGDLNPRVWEEEIKPLWEKYSKEAAQ

Molecular Weight :
25.8

Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :
Conventional Chromatography

Quality Control Testing :
15% SDS-PAGE Stained with Coomassie Blue

Storage Buffer :
In 20 mM Tris-HCl buffer, 2 mM EDTA, pH 7.5 (10% glycerol).

Applications :
SDS-PAGE,

Gene Name :
ccmG

Gene Alias :
ECK2187, JW2183, dsbE, yejQ

Gene Description :
periplasmic thioredoxin of cytochrome c-type biogenesis

Gene Summary :

Other Designations :

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CTGF site
GM-CSF Recombinant Proteins
Popular categories:
Platelet CD Proteins
Ubiquitin-Specific Peptidase 27

Share this post on:

Author: calcimimeticagent