Name :
NT5M (Human) Recombinant Protein
Biological Activity :
Human NT5M (NP_064586, 32 a.a. – 228 a.a. ) partial recombinant protein with His tag expressed in Escherichia coli.
Tag :
Protein Accession No. :
NP_064586
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=56953
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRPC
Molecular Weight :
25.1
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Conventional Chromatography
Quality Control Testing :
Storage Buffer :
In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (20% glycerol, 1 mM DTT).
Applications :
SDS-PAGE，
Gene Name :
NT5M
Gene Alias :
dNT-2, dNT2, mdN
Gene Description :
5′,3′-nucleotidase, mitochondrial
Gene Summary :
This gene encodes a 5′ nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5′- and 2′(3′)-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq
Other Designations :
5′ nucleotidase, mitochondrial|5(3)-deoxyribonucleotidase|deoxy-5′-nucleotidase 2|mitochondrial 5′ nucleotidase
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-10 ProteinMedChemExpress
FGF-9 Proteinweb
Popular categories:
ENPP-1
CD140a/PDGF-R-alpha
