Share this post on:

Name :
CKLF (Human) Recombinant Protein (P01)

Biological Activity :
Human CKLF full-length ORF (NP_058647.1, 1 a.a. – 152 a.a.) recombinant protein with GST tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_058647.1

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=51192

Amino Acid Sequence :
MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITGFEVTVILFFILLYVLRLDRLMKWLFWPLLDIINSLVTTVFMLIVSVLALIPETTTLTVGGGVFALVTAVCCLADGALIYRKLLFNPSGPYQKKPVHEKKEVL

Molecular Weight :
43.6

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (59); Rat (62)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,

Gene Name :
CKLF

Gene Alias :
C32, CKLF1, CKLF2, CKLF3, CKLF4, HSPC224, UCK-1

Gene Description :
chemokine-like factor

Gene Summary :
The product of this gene is a cytokine. Cytokines are small proteins that have an essential role in the immune and inflammatory responses. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. The protein encoded by this gene is a potent chemoattractant for neutrophils, monocytes and lymphocytes. It also can stimulate the proliferation of skeletal muscle cells. This protein may play important roles in inflammation and in the regeneration of skeletal muscle. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq

Other Designations :
chemokine-like factor 1|chemokine-like factor 2|chemokine-like factor 3|chemokine-like factor 4|transmembrane proteolipid

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
NETO1 ProteinStorage & Stability
BTLA/CD272 ProteinGene ID
Popular categories:
Signal Regulatory Protein α
MMP-7

Share this post on:

Author: calcimimeticagent