Name :
MECR (Human) Recombinant Protein (Q01)
Biological Activity :
Human MECR partial ORF ( NP_057095, 43 a.a. – 152 a.a.) recombinant protein with GST-tag at N-terminal.
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
NP_057095
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=51102
Amino Acid Sequence :
VRALVYGHHGDPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQV
Molecular Weight :
37.84
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Mouse (81); Rat (81)
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,
Gene Name :
MECR
Gene Alias :
CGI-63, FASN2B, NRBF1
Gene Description :
mitochondrial trans-2-enoyl-CoA reductase
Gene Summary :
mitochondrial
Other Designations :
OTTHUMP00000065098|OTTHUMP00000065099|homolog of yeast 2-enoyl thioester reductase|mitochondrial 2-enoyl thioester reductase|nuclear receptor binding factor 1|trans-2-enoyl-CoA reductase, mitochondrial
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
UBE2I ProteinBiological Activity
DR3/TNFRSF25 Proteinmanufacturer
Popular categories:
Adhesion G Protein-Coupled Receptor G5 (GPR114)
Lymphocyte Function Associated Antigen 1 (LFA-1)
