Name :
C6orf48 (Human) Recombinant Protein (P01)
Biological Activity :
Human C6orf48 full-length ORF ( AAH00706, 1 a.a. – 37 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
AAH00706
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=50854
Amino Acid Sequence :
MRVVMARLLSEGEQGIPTACAAFAQQPAGGHVAAWLG
Molecular Weight :
29.7
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,
Gene Name :
C6orf48
Gene Alias :
D6S57, G8
Gene Description :
chromosome 6 open reading frame 48
Gene Summary :
Other Designations :
G8 protein|OTTHUMP00000029250|OTTHUMP00000029251|OTTHUMP00000029253|OTTHUMP00000029254|OTTHUMP00000029256|OTTHUMP00000174626|OTTHUMP00000174627
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cystatin SN/CST1 ProteinStorage & Stability
PIK3IP1 ProteinPurity & Documentation
Popular categories:
Growth Differentiation Factor-8 (GDF-8)
Siglec-9
