Name :
NSDHL (Human) Recombinant Protein (Q01)
Biological Activity :
Human NSDHL partial ORF ( NP_057006, 1 a.a. – 110 a.a.) recombinant protein with GST-tag at N-terminal.
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
NP_057006
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=50814
Amino Acid Sequence :
MEPAVSEPMRDQVARTHLTEDTPKVNADIEKVNQNQAKRCTVIGGSGFLGQHMVEQLLARGYAVNVFDIQQGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCASPPPS
Molecular Weight :
37.84
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Mouse (82); Rat (82)
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,
Gene Name :
NSDHL
Gene Alias :
H105E3, SDR31E1, XAP104
Gene Description :
NAD(P) dependent steroid dehydrogenase-like
Gene Summary :
The protein encoded by this gene is localized in the endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations in this gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males. Alternatively spliced transcript variants with differing 5′ UTR have been found for this gene. [provided by RefSeq
Other Designations :
OTTHUMP00000025902|short chain dehydrogenase/reductase family 31E, member 1|sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SARS-CoV-2 NSP7 Proteinmedchemexpress
NCAM-1/CD56 ProteinFormulation
Popular categories:
E-Selectin/CD62E
BCRP/CD338
