Name :
LRP12 (Human) Recombinant Protein (P01)
Biological Activity :
Human LRP12 full-length ORF (-, 1 a.a. – 129 a.a.) recombinant protein with GST tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
–
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=29967
Amino Acid Sequence :
MKIFYYALNLELYKTCTKIVQDKFHLVMSFPNTGLRLHWTLGICTKIISRSQMSLVHKHYHFKYYYLLPQQLYISIAFGWGRGTFLLQLEIALLVSYLFVVFKKYIVVRVIFSIYFIPGGDHATLSKEN
Molecular Weight :
39.93
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,
Gene Name :
LRP12
Gene Alias :
DKFZp781F1053, FLJ12929, ST7
Gene Description :
low density lipoprotein-related protein 12
Gene Summary :
This gene was identified by its differential expression in cancer cells. The product of this gene is predicted to be a transmembrane protein. The level of this protein was found to be lower in tumor derived cell lines compared to normal cells. This gene was thus proposed to be a candidate tumor suppressor gene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations :
C820005L12Rik|suppression of tumorigenicity
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
NKp46/NCR1 Proteinweb
IL-1R2 ProteinGene ID
Popular categories:
Cyclin-Dependent Kinase 7 (CDK7)
IL-17C
