C21orf127 (Human) Recombinant Protein (Q01)

Name :
C21orf127 (Human) Recombinant Protein (Q01)

Biological Activity :
Human C21orf127 partial ORF ( NP_877426, 87 a.a. – 186 a.a.) recombinant protein with GST-tag at N-terminal.

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_877426

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=29104

Amino Acid Sequence :
LETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS

Molecular Weight :
36.74

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (76); Rat (77)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,

Gene Name :
N6AMT1

Gene Alias :
C21orf127, HEMK2, MGC19995, MTQ2, N6AMT, PRED28

Gene Description :
N-6 adenine-specific DNA methyltransferase 1 (putative)

Gene Summary :
The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq

Other Designations :
HemK methyltransferase family member 2|N-6 adenine-specific DNA methyltransferase 1|N6-DNA-methyltransferase|OTTHUMP00000096393|OTTHUMP00000096394

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IFN-gamma ProteinFormulation
SARS-CoV-2 S glycoproteinsite
Popular categories:
CXCR4
Membrane Cofactor Protein