Name :
P2RY10 (Human) Recombinant Protein (P01)
Biological Activity :
Human P2RY10 full-length ORF ( NP_055314.1, 1 a.a. – 339 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
NP_055314.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=27334
Amino Acid Sequence :
MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYASICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG
Molecular Weight :
65.2
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,
Gene Name :
P2RY10
Gene Alias :
P2Y10
Gene Description :
purinergic receptor P2Y, G-protein coupled, 10
Gene Summary :
The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. Two alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq
Other Designations :
G-protein coupled purinergic receptor P2Y10|OTTHUMP00000023599|P2Y purinoceptor 10|P2Y-like receptor
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Animal-Free IL-25/IL-17E ProteinFormulation
USP15 ProteinMedChemExpress
Popular categories:
NTB-A
Killer Cell Lectin Like Receptor G2 (KLRG2)
