Name :
TCL6 (Human) Recombinant Protein (P01)
Biological Activity :
Human TCL6 full-length ORF ( ADR82666.1, 1 a.a. – 141 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
ADR82666.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=27004
Amino Acid Sequence :
MEPRVTQRKRPLDGCMGKITGITSDILKYDHKCFKLSLPAKFPEVCGSDEVFPDPDLLHVLPVAGSLQQSIDQCCLQLESLCRPGLLCAHPTLLFKLHSSMKNRPFFSLIYTYVKKTQQVRKRDRKPRGQVAAGPNPTSVM
Molecular Weight :
15.6
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,
Gene Name :
TCL6
Gene Alias :
TCL6e1, TCL6f1, TCL6f2, TNG1, TNG2
Gene Description :
T-cell leukemia/lymphoma 6
Gene Summary :
The function of this protein has not yet been defined; however, this protein may play a role which is similar to or complementary to other T-cell leukemia/lymphoma proteins during early embrogenesis. The association of this gene with T-cell leukemia chromosome translocations implicates this gene as a candidate for leukemogenesis. Complex alternative splicing of this gene results in multiple transcript variants, six of which have been fully described. Among these described variants, four different open reading frames have been identified; three of the six variants code for an identical product.
Other Designations :
OTTHUMP00000195767|T-cell leukemia/lymphoma 6 ORF141|T-cell leukemia/lymphoma 6 ORF72|TCL1-neighboring gene 1|TCL1-neighboring gene 2
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Animal-Free Fas Ligand Proteinmedchemexpress
Animal-Free BMP-13/GDF-6 Proteinsupplier
Popular categories:
ADAMTS12
ADAMTS6
