Share this post on:

Name :
PTPN22 (Human) Recombinant Protein (Q01)

Biological Activity :
Human PTPN22 partial ORF ( NP_057051.2, 10 a.a. – 113 a.a.) recombinant protein with GST-tag at N-terminal.

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_057051.2

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=26191

Amino Acid Sequence :
FLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDF

Molecular Weight :
37.18

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :
Mouse (60); Rat (63)

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,

Gene Name :
PTPN22

Gene Alias :
LYP, Lyp1, Lyp2, PEP, PTPN8

Gene Description :
protein tyrosine phosphatase, non-receptor type 22 (lymphoid)

Gene Summary :
This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family. The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, rheumatoid arthritis, systemic lupus erythematosus and Graves’ disease. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq

Other Designations :
OTTHUMP00000013720|lymphoid-specific protein tyrosine phosphatase|protein tyrosine phosphatase, non-receptor type 8

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Leukotriene A4 Hydrolase/LTA4H Proteincustom synthesis
Cystatin C/CST3 Proteinmedchemexpress
Popular categories:
Aminopeptidase N/CD13
B Cell Maturation Antigen (BCMA)

Share this post on:

Author: calcimimeticagent