Name :
CRI1 (Human) Recombinant Protein (Q01)
Biological Activity :
Human CRI1 partial ORF ( NP_055150, 116 a.a. – 187 a.a.) recombinant protein with GST-tag at N-terminal.
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
NP_055150
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=23741
Amino Acid Sequence :
QLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE
Molecular Weight :
33.66
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Mouse (61); Rat (64)
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,
Gene Name :
EID1
Gene Alias :
C15orf3, CRI1, EID-1, IRO45620, MGC138883, MGC138884, PNAS-22, PTD014, RBP21
Gene Description :
EP300 interacting inhibitor of differentiation 1
Gene Summary :
Other Designations :
CREBBP/EP300 inhibitor 1|CREBBP/EP300 inhibitory protein 1|NB4 apoptosis related protein|Rb- and p300-binding protein EID-1|retinoblastoma protein-associated protein
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
ADCYAP1R1 Protein
ROR1 Protein
Popular categories:
Complement Component 1
Immunoglobulin Superfamily Member 11 (IGSF11)