Name :
CLCF1 (Human) Recombinant Protein (P01)
Biological Activity :
Human CLCF1 full-length ORF ( AAH12939, 29 a.a. – 225 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
AAH12939
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=23529
Amino Acid Sequence :
NRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
Molecular Weight :
47.41
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Mouse (96); Rat (95)
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,
Gene Name :
CLCF1
Gene Alias :
BSF3, CISS2, CLC, NNT1, NR6
Gene Description :
cardiotrophin-like cytokine factor 1
Gene Summary :
CLCF1 belongs to the interleukin-6 (IL6; MIM 147620) family of cytokines, which are involved in cell signaling through phosphorylation of gp130 (IL6ST; MIM 600694). IL6 family members share similarity in gene structure and have a 4-helix bundle in their protein structure.[supplied by OMIM
Other Designations :
B-cell stimulating factor 3|CRLF1 associated cytokine-like factor 1|cold-induced sweating syndrome 2|neurotrophin-1/B-cell stimulating factor-3
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-20R beta Protein
TEV Protease Protein
Popular categories:
RAR gamma
IL-17RD