Share this post on:

Name :
SLC35A3 (Human) Recombinant Protein (Q01)

Biological Activity :
Human SLC35A3 partial ORF ( NP_036375, 61 a.a. – 113 a.a.) recombinant protein with GST-tag at N-terminal.

Tag :
Best use within three months from the date of receipt of this protein.

Protein Accession No. :
NP_036375

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=23443

Amino Acid Sequence :
DSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATY

Molecular Weight :
31.57

Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Host :
Wheat Germ (in vitro)

Interspecies Antigen Sequence :

Preparation Method :
in vitro wheat germ expression system

Purification :
Glutathione Sepharose 4 Fast Flow

Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.

Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Applications :
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array,

Gene Name :
SLC35A3

Gene Alias :
DKFZp781P1297

Gene Description :
solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3

Gene Summary :
O

Other Designations :
OTTHUMP00000012506|solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member 3|solute carrier family 35 member 3A

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TGFBR1/ALK-5 Protein
Ezrin/EZR Protein
Popular categories:
Activin/Inhibins
Cyclin Dependent Kinase Inhibitor 1A (CDKN2A)

Share this post on:

Author: calcimimeticagent